Antibodies

View as table Download

Rabbit Polyclonal Anti-STRAD Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAD Antibody: A synthesized peptide derived from human STRAD

Rabbit polyclonal anti-STRAD antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STRAD.

Rabbit polyclonal Anti-LYK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the N terminal of human LYK5. Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL

Rabbit polyclonal Anti-LYK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the C terminal of human LYK5. Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV