Antibodies

Jump to Filters
View as table Download
BMPER Rabbit Polyclonal Antibody
TA340276

USD 375.00

5 Days

Rabbit Polyclonal Anti-BMPER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMPER antibody: synthetic peptide directed towards the C terminal of human BMPER. Synthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV