SERPINB2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
SERPINB2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-SERPINB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ |
SERPINB2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PAI2 |
Rabbit polyclonal Plasminogen Activator Inhibitor 2 antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal area of human PAI-2 protein. |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SERPINB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SERPINB2 |
SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
SERPINB2 mouse monoclonal antibody,clone 1G3, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SERPINB2 mouse monoclonal antibody,clone 1G3, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".