Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
TAC1 rat monoclonal antibody, clone NC1/34, Supernatant
| Applications | IF, IHC |
| Reactivities | Human |
TAC1 guinea pig polyclonal antibody, Serum
| Applications | FC, IHC |
| Reactivities | Fish, Human, Rabbit, Rat |
| Immunogen | Substance P conjugated to BSA |
TAC1 rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Fish, Human, Porcine, Rat |
| Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |
Rabbit Polyclonal Anti-TAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
Anti-TAC1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 58-68 amino acids of Human tachykinin, precursor 1 |
Active filters
Target Symbol
- TAC1
Families
- Secreted Protein