Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Rabbit polyclonal Plasminogen Activator Inhibitor 2 antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal area of human PAI-2 protein.

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SERPINB2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SERPINB2

SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

SERPINB2 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

SERPINB2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated