Antibodies

View as table Download

Rabbit Polyclonal Anti-MSTN Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN

Rabbit anti GDF-8 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI6A7 (formerly 6A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSTN mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MSTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 354-366 amino acids of Human myostatin

MSTN mouse monoclonal antibody, clone OTI7H5 (formerly 7H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MSTN mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSTN mouse monoclonal antibody, clone OTI6A7 (formerly 6A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSTN mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MSTN mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated