Myostatin Propeptide (MSTN) Rabbit Polyclonal Antibody

CAT#: TA343358

Rabbit Polyclonal Anti-MSTN Antibody

Product Images

Host: Rabbit; Target Name: Mstn; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: myostatin
• Database Link:
  NP_005250
  Entrez Gene 17700 Mouse
  UniProt ID O14793
• Background: Mstn acts specifically as a negative regulator of skeletal muscle growth.
• Synonyms: GDF8; MSLHP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein