Antibodies

Jump to Filters
View as table Download
PFD6 (PFDN6) Rabbit Polyclonal Antibody
TA340180

USD 375.00

5 Days

Rabbit Polyclonal Anti-PFDN6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFDN6 antibody: synthetic peptide directed towards the N terminal of human PFDN6. Synthetic peptide located within the following region: MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL
PFD6 (PFDN6) Rabbit Polyclonal Antibody
TA350908

USD 345.00

In Stock

Rabbit Polyclonal Anti-PFDN6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFDN6