PFD6 (PFDN6) Rabbit Polyclonal Antibody

CAT#: TA340180

Rabbit Polyclonal Anti-PFDN6 Antibody

Product Images

WB Suggested Anti-PFDN6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFDN6 antibody: synthetic peptide directed towards the N terminal of human PFDN6. Synthetic peptide located within the following region: MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: prefoldin subunit 6
• Database Link:
  NP_055075
  Entrez Gene 10471 Human
  UniProt ID O15212
• Background: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
• Synonyms: H2-KE2; HKE2; KE-2; PFD6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 91%

Reference Data

• Protein Families: Stem cell - Pluripotency