Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DAXX rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Daxx Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Daxx antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Daxx. The immunogen is located within the last 50 amino acids of Daxx. |
Rabbit polyclonal anti-DAXX antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 261-274 of human DAXX protein. |
Rabbit Polyclonal Anti-DAXX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DAXX antibody is: synthetic peptide directed towards the C-terminal region of Human DAXX. Synthetic peptide located within the following region: VSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHE |
Active filters
Target Symbol
- DAXX
Families
- Stem cell - Pluripotency