Antibodies

View as table Download

Rabbit Polyclonal antibody to SET (SET nuclear oncogene)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of SET

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

TSTD3 (TAF-I beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat

TSTD3 (N-term) goat polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Chicken, Human
Immunogen Synthetic peptide from N-terminus of human SET

Goat Polyclonal Antibody against SET / I2 alpha PP2A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SAPAAKVSKKELNS-C, from the N Terminus of the protein sequence according to AAC50460.1.