Antibodies

View as table Download

Rabbit anti-WIF1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WIF1

Rabbit Polyclonal Antibody against WIF1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1.

Rabbit Polyclonal Antibody against WIF1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 347-376 amino acids from the C-terminal region of human WIF1.

Rabbit Polyclonal Anti-WIF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WIF1 antibody: synthetic peptide directed towards the N terminal of human WIF1. Synthetic peptide located within the following region: RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN