Rabbit Polyclonal Anti-HOXB9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXB9 antibody: synthetic peptide directed towards the N terminal of human HOXB9. Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV |
Rabbit polyclonal anti-HOXB9 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HOXB9. |
Rabbit Polyclonal Anti-Hoxb9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxb9 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb9. Synthetic peptide located within the following region: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC |
Germany
Japan
United Kingdom
China
