Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLF11 |
Antibodies
View as table Download
Rabbit polyclonal TIEG2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TIEG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-36 amino acids from the N-terminal region of human TIEG2. |
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 Antibody: A synthesized peptide derived from human KLF11 |
Rabbit polyclonal anti-KLF11 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KLF11. |
Rabbit Polyclonal anti-KLF11 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 antibody: synthetic peptide directed towards the N terminal of human KLF11. Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ |
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 antibody: synthetic peptide directed towards the C terminal of human KLF11. Synthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP |
Active filters
Target Symbol
- KLF11
Isotypes
- IgG
Families
- Transcription Factors