FKLF / KLF11 (KLF11) Rabbit Polyclonal Antibody

CAT#: TA329657

Rabbit Polyclonal anti-KLF11 antibody

Product Images

WB Suggested Anti-KLF11 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF11 antibody: synthetic peptide directed towards the N terminal of human KLF11. Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: Kruppel-like factor 11
• Database Link:
  NP_003588
  Entrez Gene 8462 Human
  UniProt ID O14901
• Background: KLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
• Synonyms: FKLF; FKLF1; MODY7; TIEG2; Tieg3
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 92%; Rat: 90%; Guinea pig: 86%; Rabbit: 77%

Reference Data

• Protein Families: Transcription Factors