Rabbit Polyclonal Anti-PHF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF11 antibody: synthetic peptide directed towards the n terminal of human PHF11. Synthetic peptide located within the following region: MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHC |
Rabbit Polyclonal Anti-PHF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF11 antibody: synthetic peptide directed towards the middle region of human PHF11. Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF |
Germany
Japan
United Kingdom
China