PHF11 Rabbit Polyclonal Antibody

CAT#: TA338331

Rabbit Polyclonal Anti-PHF11 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PHF11"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PHF11 antibody: synthetic peptide directed towards the middle region of human PHF11. Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name PHD finger protein 11
Background PHF11 contains two PHD zinc fingers and probably regulates transcription. Distinctive splice variants were expressed in immune tissues and cells.
Synonyms APY; BCAP; IGEL; IGER; IGHER; NY-REN-34; NYREN34
Note Immunogen Sequence Homology: Human: 100%; Dog: 85%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.