Rabbit Polyclonal Anti-PHF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF11 antibody: synthetic peptide directed towards the n terminal of human PHF11. Synthetic peptide located within the following region: MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHC |
Goat Anti-PHF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KIHASQQRWQQLKE, from the internal region of the protein sequence according to NP_001035533.1; NP_001035534.1. |
Rabbit polyclonal anti-PHF11 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PHF11 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 158-191 amino acids from the Central region of human PHF11. |
Rabbit Polyclonal Anti-PHF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF11 antibody: synthetic peptide directed towards the middle region of human PHF11. Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF |
PHF11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PHF11 |
PHF11 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human PHF11 (NP_001035533.1). |
| Modifications | Unmodified |
PHF11 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human PHF11 (NP_001035533.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China