Antibodies

Jump to Filters
View as table Download
TLE4 Rabbit Polyclonal Antibody
TA330275

USD 375.00

5 Days

Rabbit Polyclonal Anti-TLE4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLE4 antibody: synthetic peptide directed towards the N terminal of human TLE4. Synthetic peptide located within the following region: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS
TLE4 Rabbit Polyclonal Antibody
TA314630

USD 345.00

4 Weeks

Rabbit polyclonal anti-TLE4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TLE4.