TLE4 Rabbit Polyclonal Antibody

CAT#: TA330275

Rabbit Polyclonal Anti-TLE4 Antibody

Product Images

WB Suggested Anti-TLE4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate

• 

  Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TLE4 antibody: synthetic peptide directed towards the N terminal of human TLE4. Synthetic peptide located within the following region: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: transducin like enhancer of split 4
• Database Link:
  NP_008936
  Entrez Gene 7091 Human
  UniProt ID Q04727
• Background: TLE4 is the transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
• Synonyms: BCE-1; BCE1; E(spI); ESG; ESG4; Grg-4; GRG4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors