Antibodies

View as table Download

Rabbit Polyclonal anti-Elongin C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant full-length

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the N terminal of human TCEB1. Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein