ELOC Rabbit Polyclonal Antibody

CAT#: TA330158

Rabbit Polyclonal Anti-TCEB1 Antibody

Product Images

WB Suggested Anti-TCEB1 Antibody Titration: 1.0 ug/ml; Positive Control: Jurkat cell lysateTCEB1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: transcription elongation factor B subunit 1
• Database Link:
  NP_005639
  Entrez Gene 6921 Human
  UniProt ID Q15369
• Background: TCEB1 is known as protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Western blots using two different antibodies (P100962-T200 and P100963_P050 / P100963_P100) against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: eloC; SIII
• Note: Immunogen sequence homology: African clawed frog: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis