Antibodies

Jump to Filters
View as table Download
NFKBIL1 (Center) Rabbit Polyclonal Antibody
AP52865PU-N

USD 450.00

2 Weeks

NFKBIL1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 256-289aa) of human NFKBIL1
NFKBIL1 (C-term) Rabbit Polyclonal Antibody
AP52866PU-N

USD 450.00

2 Weeks

NFKBIL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 334-364aa) of human NFKBIL1
NFKBIL1 Rabbit Polyclonal Antibody
TA343495

USD 375.00

5 Days

Rabbit Polyclonal Anti-NFKBIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFKBIL1 antibody: synthetic peptide directed towards the N terminal of human NFKBIL1. Synthetic peptide located within the following region: MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQ