NFKBIL1 Rabbit Polyclonal Antibody

CAT#: TA343495

Rabbit Polyclonal Anti-NFKBIL1 Antibody

Product Images

WB Suggested Anti-NFKBIL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFKBIL1 antibody: synthetic peptide directed towards the N terminal of human NFKBIL1. Synthetic peptide located within the following region: MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: NFKB inhibitor like 1
• Database Link:
  NP_004998
  Entrez Gene 4795 Human
  UniProt ID Q9UBC1
• Background: NFKBIL1 is a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isofor
• Synonyms: IKBL; LST1; NFKBIL
• Note: Immunogen Sequence Homology: Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Dog: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors