Antibodies

View as table Download

Rabbit Polyclonal CITED2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CITED2.

Rabbit polyclonal anti-CITED2 antibody (NT)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid peptide near the amino terminus of human CITED2.

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: ADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNAL