Antibodies

View as table Download

Rabbit polyclonal anti-MNDA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MNDA.

Rabbit Polyclonal Anti-MNDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MNDA Antibody: synthetic peptide directed towards the C terminal of human MNDA. Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN

Carrier-free (BSA/glycerol-free) MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

MNDA mouse monoclonal antibody, clone OTI4H6 (formerly 4H6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated