Antibodies

Jump to Filters
View as table Download
PFDN1 Rabbit Polyclonal Antibody
TA347772

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PFDN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFDN1 Antibody: A synthesized peptide derived from human PFDN1
PFDN1 Rabbit Polyclonal Antibody
TA314331

USD 345.00

In Stock

Rabbit polyclonal anti-PFDN1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PFDN1.
PFDN1 Goat Polyclonal Antibody
TA311241

USD 375.00

5 Days

Goat Anti-Prefoldin / PFDN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNIREMLMARRAQ, from the C Terminus of the protein sequence according to NP_002613.2.
PFDN1 Rabbit Polyclonal Antibody
TA332123

USD 310.00

5 Days

Rabbit Polyclonal Anti-PFDN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PFDN1 Antibody: synthetic peptide directed towards the N terminal of human PFDN1. Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE