PFDN1 Rabbit Polyclonal Antibody

CAT#: TA332123

Rabbit Polyclonal Anti-PFDN1 Antibody

Product Images

WB Suggested Anti-PFDN1 Antibody Titration: 5.0-8.0ug/ml; Positive Control: HepG2 cell lysatePFDN1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PFDN1 Antibody: synthetic peptide directed towards the N terminal of human PFDN1. Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: prefoldin subunit 1
• Database Link:
  NP_002613
  Entrez Gene 5201 Human
  UniProt ID O60925
• Background: Prefoldin 1 is a heterohexameric chaperone protein which assists in the correct folding of other proteins. It binds specifically to cytosolic chaperonin and transfers target proteins. Prefoldin may function by selectively targeting nascent actin and tubulin chains pending their transfer to cytosolic chaperonin for final folding and/or assembly. It promotes folding in an environment in which there are many competing pathways for nonnative proteins.
• Synonyms: PDF; PFD1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 92%

Reference Data

• Protein Families: Transcription Factors