Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-PFDN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFDN1 Antibody: A synthesized peptide derived from human PFDN1 |
Antibodies
View as table Download
Rabbit polyclonal anti-PFDN1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PFDN1. |
PFDN1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Goat Anti-Prefoldin / PFDN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DNIREMLMARRAQ, from the C Terminus of the protein sequence according to NP_002613.2. |
Rabbit Polyclonal Anti-PFDN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PFDN1 Antibody: synthetic peptide directed towards the N terminal of human PFDN1. Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE |
PFDN1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PFDN1 |
PFDN1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human PFDN1 (NP_002613.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PFDN1