Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1. |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1. |
Rabbit Polyclonal anti-SPIB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPIB antibody: synthetic peptide directed towards the C terminal of human SPIB. Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA |
Rabbit Polyclonal Anti-SPIB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPIB Antibody: synthetic peptide directed towards the middle region of human SPIB. Synthetic peptide located within the following region: WGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRR |
Rabbit Polyclonal Spi-B Antibody
Applications | WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 15-65 of human Spi-B was used as the immunogen. |