Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the middle region of human TCF12. Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: IGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF12 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF12. Synthetic peptide located within the following region: AVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSE |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI1G10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI1G10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- TCF12
Reactivities
- Human
Families
- Transcription Factors