Rabbit Polyclonal TCF12 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF12 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCF12. |
Rabbit Polyclonal TCF12 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF12 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCF12. |
Rabbit Polyclonal Anti-TCF12 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE |
Rabbit Polyclonal Anti-TCF12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the middle region of human TCF12. Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS |
Rabbit Polyclonal Anti-TCF12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: IGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW |
Rabbit Polyclonal Anti-TCF12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF12 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF12. Synthetic peptide located within the following region: AVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSE |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI4A7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI4D6G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI3C11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI2E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI3D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TCF12 mouse monoclonal antibody,clone OTI4A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI4B5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI4B5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI4A7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI4A7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI4A7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI4A7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI1G10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI1G10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI4D6G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI4D6G8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI4D6G8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI4D6G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI3C11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI3C11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI3C11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI3C11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI2E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI2E11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI2E11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI2E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI1F11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI1F11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TCF12 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TCF12 mouse monoclonal antibody,clone OTI3D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCF12 mouse monoclonal antibody,clone OTI3D2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TCF12 mouse monoclonal antibody,clone OTI3D2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |