Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)
Applications | WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)
Applications | WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CAF1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CAF1B. |
Rabbit Polyclonal Anti-CHAF1B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD |
Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".