Antibodies

View as table Download

Rabbit polyclonal anti-TF2H1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H1.

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK