Antibodies

Jump to Filters
View as table Download
mtTFA (TFAM) Rabbit Polyclonal Antibody
TA332462

USD 275.00

3 Weeks

Rabbit anti-TFAM Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFAM
mtTFA (TFAM) Rabbit Polyclonal Antibody
TA329264

USD 375.00

5 Days

Rabbit Polyclonal anti-TFAM antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM. Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS