PBX3 mouse monoclonal antibody, clone 1A11, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
PBX3 mouse monoclonal antibody, clone 1A11, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Pbx3 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-PBX3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3. Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM |