Antibodies

View as table Download

BACH1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 670-698 amino acids from the C-terminal region of human BACH1

Rabbit polyclonal anti-BACH1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BACH1.

Rabbit Polyclonal Anti-BACH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACH1 antibody: synthetic peptide directed towards the C terminal of human BACH1. Synthetic peptide located within the following region: PPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGGISDFCQQMTD

Carrier-free (BSA/glycerol-free) BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated