Antibodies

Jump to Filters
View as table Download
EBF1 Goat Polyclonal Antibody
TA305686

USD 375.00

5 Days

Goat Anti-EBF1 / COE1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HNQLPALANTSV, from the internal region of the protein sequence according to NP_076870.1.
EBF1 Rabbit Polyclonal Antibody
TA345374

USD 475.00

5 Days

Rabbit Polyclonal Anti-EBF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF1 antibody: synthetic peptide directed towards (50ug) human EBF1.. Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
EBF1 Rabbit Polyclonal Antibody
TA329356

USD 375.00

5 Days

Rabbit Polyclonal anti-EBF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF1 antibody: synthetic peptide directed towards the N terminal of human EBF1. Synthetic peptide located within the following region: MCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCL