Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ELF4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELF4. |
Rabbit polyclonal ELF4 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ELF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 211-237 amino acids from the Central region of human ELF4. |
ELF4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 168-196aa) of human ELF4. |
Rabbit Polyclonal anti-ELF4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: RKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKY |
Rabbit Polyclonal Anti-ELF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the C terminal of human ELF4. Synthetic peptide located within the following region: VTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS |
Rabbit Polyclonal Anti-ELF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI1E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF4 mouse monoclonal antibody,clone OTI1E11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI1E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI1E4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELF4 mouse monoclonal antibody,clone OTI1E4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELF4 mouse monoclonal antibody,clone OTI1E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2G1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELF4 mouse monoclonal antibody,clone OTI2G1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELF4 mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2F6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELF4 mouse monoclonal antibody,clone OTI2F6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELF4 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI5E4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELF4 mouse monoclonal antibody,clone OTI5E4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELF4 mouse monoclonal antibody,clone OTI5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI2A3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELF4 mouse monoclonal antibody,clone OTI2A3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELF4 mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELF4 mouse monoclonal antibody,clone OTI1E11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ELF4 mouse monoclonal antibody,clone OTI1E11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Active filters
Target Symbol
- ELF4
Families
- Transcription Factors