Antibodies

View as table Download

Rabbit Polyclonal Anti-SOX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS

Rabbit Polyclonal Anti-SOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the N terminal of human SOX15. Synthetic peptide located within the following region: MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVK

Rabbit Polyclonal Anti-SOX15 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the N terminal of human SOX15. Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR

Rabbit polyclonal SOX15 Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SOX15 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-125 amino acids from the Central region of human SOX15.

Goat Polyclonal Antibody against SOX15

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CSLPQSDPRLQGE, from the internal region of the protein sequence according to NP_008873.1.

Rabbit Polyclonal Anti-SOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX15 Antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: SHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMP