Antibodies

Jump to Filters
View as table Download
NFKBIL2 (TONSL) Rabbit Polyclonal Antibody
TA330108

USD 375.00

5 Days

Rabbit Polyclonal Anti-TONSL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFKBIL2 antibody: synthetic peptide directed towards the middle region of human NFKBIL2. Synthetic peptide located within the following region: RAIIHVSLATTLGDMKDHHGAVRHYEEELRLRSGNVLEEAKTWLNIALSR
NFKBIL2 (TONSL) Rabbit Polyclonal Antibody
TA322397

USD 345.00

In Stock

Anti-TONSL Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human tonsoku-like, DNA repair protein
NFKBIL2 (TONSL) Rabbit Polyclonal Antibody
TA322398

USD 345.00

In Stock

Anti-TONSL Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human tonsoku-like, DNA repair protein