Rabbit Polyclonal Anti-ZBTB25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB25 antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV |
Rabbit Polyclonal Anti-ZBTB25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB25 Antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: ADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTF |
Germany
Japan
United Kingdom
China
