GPR40 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Tested: |
| Conjugation | Unconjugated |
| Immunogen | FFAR1 / GPR40 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR40. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Mouse, Hamster, Pig (84%). |
Goat Polyclonal Antibody against GPR40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1. |
Rabbit Polyclonal Anti-FFAR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV |
Germany
Japan
United Kingdom
China