Antibodies

View as table Download

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1

Rabbit Polyclonal Anti-GJC1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1