Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIP12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12.

Rabbit polyclonal anti-EDG5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG5.

Rabbit Polyclonal Anti-S1PR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE

Rabbit Polyclonal Anti-S1PR2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human S1PR2