Antibodies

View as table Download

Rabbit Polyclonal BAFF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF.

Rabbit anti-TNFSF13B Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFSF13B

Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Anti-Human BAFF Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BAFF

Biotinylated Anti-Human BAFF Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BAFF

Rabbit anti BAFF/BLys/Thank/Tall-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated