Rabbit polyclonal CSGALNACT1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
Rabbit polyclonal CSGALNACT1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
Rabbit Polyclonal Anti-B3GAT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human B3GAT1 |
Rabbit Polyclonal beta-1,3-Glucuronyltransferase 1/B3GAT1/CD57 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human CD57 protein (between residues 1-50) [UniProt Q9P2W7] |
Rabbit Polyclonal Anti-Chst11 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS |
Rabbit Polyclonal Anti-CSGALNACT2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSGALNACT2 |