Antibodies

View as table Download

Rabbit monoclonal antibody against INPP4A(clone EP3425(2))

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Anti-ALDH6A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1