Germany
Japan
United Kingdom
China
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Goat Polyclonal Anti-FCRL1 (aa165-177) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCRL1 (aa165-177) Antibody: Peptide with sequence C-TAEYEIPSVRESD, from the internal region of the protein sequence according to NP_443170.1; NP_001152869.1; NP_001152870.1. |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit Polyclonal Anti-UBE2J2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Rabbit polyclonal anti-UBE2J1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues near the amino terminus of the human Ube2j1 protein. |
Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein. |
Goat Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_115807.1; NP_757385.1 (HERQHLEARLQS) |
Rabbit Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA |
Rabbit Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6B1 (formerly 6B1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FBXW7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBXW7 |
USD 420.00
5 Days
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
5 Days
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 2D4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 2D4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1H10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1H10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Families
- Transmembrane
Pathways
- Ubiquitin mediated proteolysis