FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-FCRL1 (aa165-177) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FCRL1 (aa165-177) Antibody: Peptide with sequence C-TAEYEIPSVRESD, from the internal region of the protein sequence according to NP_443170.1; NP_001152869.1; NP_001152870.1. |
FBXW7 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit Polyclonal Anti-UBE2J2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Rabbit polyclonal anti-UBE2J1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues near the amino terminus of the human Ube2j1 protein. |
Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein. |
Goat Polyclonal Anti-SYVN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_115807.1; NP_757385.1 (HERQHLEARLQS) |
Rabbit Polyclonal Anti-SYVN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA |
Rabbit Polyclonal Anti-SYVN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody,clone OTI3D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI2G2 (formerly 2G2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI10B9 (formerly 10B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6B1 (formerly 6B1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SYVN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human synovial apoptosis inhibitor 1, synoviolin |
Rabbit Polyclonal Anti-FBXW7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBXW7 |
UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3C11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3C11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3E6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3E6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 2D4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 2D4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1H10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1H10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1F6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1F6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |