Antibodies

View as table Download

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-ALDH6A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation HRP