Antibodies

View as table Download

Mouse Monoclonal NHE3 [p Ser552] Antibody (14D5)

Applications WB
Reactivities Human, Mouse, Rabbit, Rat, Opossum
Conjugation Unconjugated

Rabbit Polyclonal Anti-SLC9A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC9A3 Antibody: synthetic peptide directed towards the middle region of human SLC9A3. Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR

Anti-SLC9A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 397-411 amino acids of Human solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3

Anti-SLC9A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 397-411 amino acids of Human solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3